PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G202800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 184aa    MW: 19832.5 Da    PI: 7.8084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G202800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.8e-45101091100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++
  Aqcoe3G202800.1.p  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVHRLQT 101
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el+++++e
  Aqcoe3G202800.1.p 102 ELDAANAE 109
                        **999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8439110IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MASSNSSNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQRQVHRLQ TELDAANAEL IRYACNEMPT  120
AMPISPGTGA QAIISRQRSI EFGTRMVNGG GSFYQTPDMP LPYPSPWPDN SSSGNIHGSG  180
SGN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248605.11e-100PREDICTED: LOB domain-containing protein 25-like
RefseqXP_010248606.11e-100PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML49e-73LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW92e-99B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.15e-99(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.49e-70LBD family protein